SCOPe 2.08: Domain d5lkwa_: 5lkw A:

Lineage for d5lkwa_ (5lkw A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [336981] (2 PDB entries)

8. Domain d5lkwa_: 5lkw A: [337908]
   automated match to d4b5cb_
   complexed with api

Details for d5lkwa_

PDB Entry: 5lkw, 2 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein (pal) from burkholderia cepacia in complex with dap

PDB Compounds: (A:) putative ompa family lipoprotein

SCOPe Domain Sequences for d5lkwa_:

Sequence; same for both SEQRES and ATOM records:

>d5lkwa_ d.79.7.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
dplndpnsplakrsiyfdfdsysvkdeyqplmqqhaqylkshpqrhvliqgntdergtse
ynlalgqkraeavrramallgvndsqmeavslgkekpqatghdeaswaqnrradlvyqq

Timeline for d5lkwa_:

• d5lkwa_ first appeared in SCOPe 2.06
  
• d5lkwa_ appears in SCOPe 2.07