Lineage for d5llaa_ (5lla A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2812658Protein automated matches [190681] (2 species)
    not a true protein
  7. 2812668Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)
  8. 2812706Domain d5llaa_: 5lla A: [337905]
    automated match to d3d0na_
    complexed with 6yq, cit, edo, zn

Details for d5llaa_

PDB Entry: 5lla (more details), 1.5 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 4-(1h- benzimidazol-1-ylacetyl)-2-chlorobenzenesulfonamide
PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5llaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llaa_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d5llaa_:

Click to download the PDB-style file with coordinates for d5llaa_.
(The format of our PDB-style files is described here.)

Timeline for d5llaa_: