SCOPe 2.06: Domain d5lnxb2: 5lnx B:227-377

Lineage for d5lnxb2 (5lnx B:227-377)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [337850] (1 PDB entry)

8. Domain d5lnxb2: 5lnx B:227-377 [337883]
   Other proteins in same PDB: d5lnxa1, d5lnxb1, d5lnxc1, d5lnxd1, d5lnxe1, d5lnxf1, d5lnxg1, d5lnxh1
   automated match to d3mdea1
   complexed with fad, gol

Details for d5lnxb2

PDB Entry: 5lnx, 2.6 Å

PDB Description: crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5lnxb2:

Sequence, based on SEQRES records:

>d5lnxb2 a.29.3.0 (B:227-377) automated matches {Bacillus subtilis [TaxId: 224308]}
gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm
atraeaarhlvyhaadlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdyp
verllrdakvtqiyegtneiqrliiskyllgg

Sequence, based on observed residues (ATOM records):

>d5lnxb2 a.29.3.0 (B:227-377) automated matches {Bacillus subtilis [TaxId: 224308]}
gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm
atraeaarhlvyhaadlhnrglncgkeasmakqfasdaavkaldavqiyggygymkdypv
erllrdakvtqiyegtneiqrliiskyllgg

Timeline for d5lnxb2:

• d5lnxb2 is new in SCOPe 2.06-stable
  
• d5lnxb2 appears in SCOPe 2.07
  
• d5lnxb2 appears in the current release, SCOPe 2.08