Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (26 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [337850] (1 PDB entry) |
Domain d5lnxb2: 5lnx B:227-377 [337883] Other proteins in same PDB: d5lnxa1, d5lnxb1, d5lnxc1, d5lnxd1, d5lnxe1, d5lnxf1, d5lnxg1, d5lnxh1 automated match to d3mdea1 complexed with fad, gol |
PDB Entry: 5lnx (more details), 2.6 Å
SCOPe Domain Sequences for d5lnxb2:
Sequence, based on SEQRES records: (download)
>d5lnxb2 a.29.3.0 (B:227-377) automated matches {Bacillus subtilis [TaxId: 224308]} gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm atraeaarhlvyhaadlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdyp verllrdakvtqiyegtneiqrliiskyllgg
>d5lnxb2 a.29.3.0 (B:227-377) automated matches {Bacillus subtilis [TaxId: 224308]} gdgfhiamanlnvgrigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladm atraeaarhlvyhaadlhnrglncgkeasmakqfasdaavkaldavqiyggygymkdypv erllrdakvtqiyegtneiqrliiskyllgg
Timeline for d5lnxb2: