![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein Purine nucleoside phosphorylase, PNP [53169] (13 species) |
![]() | Species Cellulomonas sp. [TaxId:40001] [53173] (2 PDB entries) |
![]() | Domain d1c3xb_: 1c3x B: [33788] complexed with 8ig, ca, po4 |
PDB Entry: 1c3x (more details), 2.4 Å
SCOPe Domain Sequences for d1c3xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3xb_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp. [TaxId: 40001]} pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl shaevieagqaagprisalladiakr
Timeline for d1c3xb_: