| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Hemapoetic cell kinase Hck [50062] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
| Domain d5nuhd_: 5nuh D: [337878] Other proteins in same PDB: d5nuha_, d5nuhb_ automated match to d5hcka_ |
PDB Entry: 5nuh (more details), 2.78 Å
SCOPe Domain Sequences for d5nuhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nuhd_ b.34.2.1 (D:) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
diivvalydyegwwgdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvar
Timeline for d5nuhd_: