![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.102: Regulatory factor Nef [55670] (1 superfamily) alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) ![]() |
![]() | Family d.102.1.0: automated matches [191617] (1 protein) not a true family |
![]() | Protein automated matches [191127] (2 species) not a true protein |
![]() | Species Simian immunodeficiency virus [TaxId:388909] [189212] (2 PDB entries) |
![]() | Domain d5nuhb_: 5nuh B: [337875] Other proteins in same PDB: d5nuhc_, d5nuhd_ automated match to d3ik5a_ |
PDB Entry: 5nuh (more details), 2.78 Å
SCOPe Domain Sequences for d5nuhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nuhb_ d.102.1.0 (B:) automated matches {Simian immunodeficiency virus [TaxId: 388909]} rpkvplrtmsyklaidmshfikekgglegiyysarrhrildiylekeegiipdwqdytsg pgirypktfgwlwklvpvnvsdeaqedeehylmhpaqtsqwddpwgevlawkfdptlayt yeayvrypeef
Timeline for d5nuhb_: