Lineage for d5nuhb_ (5nuh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967561Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2967562Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2967584Family d.102.1.0: automated matches [191617] (1 protein)
    not a true family
  6. 2967585Protein automated matches [191127] (2 species)
    not a true protein
  7. 2967591Species Simian immunodeficiency virus [TaxId:388909] [189212] (2 PDB entries)
  8. 2967595Domain d5nuhb_: 5nuh B: [337875]
    Other proteins in same PDB: d5nuhc_, d5nuhd_
    automated match to d3ik5a_

Details for d5nuhb_

PDB Entry: 5nuh (more details), 2.78 Å

PDB Description: crystal structure of sivmac239 nef bound to an engineered hck sh3 domain
PDB Compounds: (B:) Protein Nef

SCOPe Domain Sequences for d5nuhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuhb_ d.102.1.0 (B:) automated matches {Simian immunodeficiency virus [TaxId: 388909]}
rpkvplrtmsyklaidmshfikekgglegiyysarrhrildiylekeegiipdwqdytsg
pgirypktfgwlwklvpvnvsdeaqedeehylmhpaqtsqwddpwgevlawkfdptlayt
yeayvrypeef

SCOPe Domain Coordinates for d5nuhb_:

Click to download the PDB-style file with coordinates for d5nuhb_.
(The format of our PDB-style files is described here.)

Timeline for d5nuhb_: