Lineage for d5mjzb_ (5mjz B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010940Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2010941Protein automated matches [191037] (12 species)
    not a true protein
  7. 2010966Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)
  8. 2010970Domain d5mjzb_: 5mjz B: [337873]
    automated match to d5crua_

Details for d5mjzb_

PDB Entry: 5mjz (more details), 1.87 Å

PDB Description: crystal structure of the his domain protein tyrosine phosphatase (hd- ptp/ptpn23) bro1 domain (apo structure)
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 23

SCOPe Domain Sequences for d5mjzb_:

Sequence, based on SEQRES records: (download)

>d5mjzb_ a.118.8.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvprdf
egcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilynlg
alhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnlml
gqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkklvq
mkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrftm
dviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifaklv

Sequence, based on observed residues (ATOM records): (download)

>d5mjzb_ a.118.8.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvprdf
egcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilynlg
alhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnlml
gqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkklvq
mkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrftm
dviggkynsakkdndfiyheavpalqpvkgaplvkplpvnptdpavtgpdifaklv

SCOPe Domain Coordinates for d5mjzb_:

Click to download the PDB-style file with coordinates for d5mjzb_.
(The format of our PDB-style files is described here.)

Timeline for d5mjzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5mjza_