Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (5 species) |
Species Cellulomonas sp. [TaxId:40001] [53173] (2 PDB entries) |
Domain d1c3xa_: 1c3x A: [33787] |
PDB Entry: 1c3x (more details), 2.4 Å
SCOP Domain Sequences for d1c3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3xa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp.} pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl shaevieagqaagprisalladiakr
Timeline for d1c3xa_: