Lineage for d1c3xa_ (1c3x A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25491Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
  5. 25492Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins)
  6. 25497Protein Purine nucleoside phosphorylase, PNP [53169] (4 species)
  7. 25498Species Cellulomonas sp. [TaxId:40001] [53173] (2 PDB entries)
  8. Domain d1c3xa_: 1c3x A: [33787]

Details for d1c3xa_

PDB Entry: 1c3x (more details), 2.4 Å

PDB Description: purine nucleoside phosphorylase from cellulomonas sp. in complex with 8-iodo-guanine

SCOP Domain Sequences for d1c3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3xa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp.}
pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
shaevieagqaagprisalladiakr

SCOP Domain Coordinates for d1c3xa_ are not available.

Timeline for d1c3xa_:

Domains from other chains:
(mouse over for more information)
d1c3xb_, d1c3xc_