Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (5 species) |
Species Cellulomonas sp. [TaxId:40001] [53173] (2 PDB entries) |
Domain d1qe5c_: 1qe5 C: [33786] |
PDB Entry: 1qe5 (more details), 2.2 Å
SCOP Domain Sequences for d1qe5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qe5c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp.} pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl shaevieagqaagprisalladiakr
Timeline for d1qe5c_: