Lineage for d1qe5c_ (1qe5 C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72323Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
  5. 72324Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins)
  6. 72329Protein Purine nucleoside phosphorylase, PNP [53169] (5 species)
  7. 72330Species Cellulomonas sp. [TaxId:40001] [53173] (2 PDB entries)
  8. 72333Domain d1qe5c_: 1qe5 C: [33786]

Details for d1qe5c_

PDB Entry: 1qe5 (more details), 2.2 Å

PDB Description: purine nucleoside phosphorylase from cellulomonas sp. in complex with phosphate

SCOP Domain Sequences for d1qe5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe5c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp.}
pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
shaevieagqaagprisalladiakr

SCOP Domain Coordinates for d1qe5c_:

Click to download the PDB-style file with coordinates for d1qe5c_.
(The format of our PDB-style files is described here.)

Timeline for d1qe5c_: