Lineage for d5mjza_ (5mjz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334081Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2334082Protein automated matches [191037] (12 species)
    not a true protein
  7. 2334109Species Human (Homo sapiens) [TaxId:9606] [255451] (12 PDB entries)
  8. 2334110Domain d5mjza_: 5mjz A: [337858]
    automated match to d5crua_

Details for d5mjza_

PDB Entry: 5mjz (more details), 1.87 Å

PDB Description: crystal structure of the his domain protein tyrosine phosphatase (hd- ptp/ptpn23) bro1 domain (apo structure)
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 23

SCOPe Domain Sequences for d5mjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mjza_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
v

SCOPe Domain Coordinates for d5mjza_:

Click to download the PDB-style file with coordinates for d5mjza_.
(The format of our PDB-style files is described here.)

Timeline for d5mjza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5mjzb_