Lineage for d5fehe2 (5feh E:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752242Domain d5fehe2: 5feh E:107-214 [337832]
    Other proteins in same PDB: d5feha1, d5fehb_, d5fehc1, d5fehd_, d5fehe1, d5fehf_
    automated match to d1dn0a2
    complexed with edo, so4

Details for d5fehe2

PDB Entry: 5feh (more details), 3.1 Å

PDB Description: crystal structure of pct64_35b, a broadly neutralizing anti-hiv antibody
PDB Compounds: (E:) PCT64_26 Fab light chain

SCOPe Domain Sequences for d5fehe2:

Sequence, based on SEQRES records: (download)

>d5fehe2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records): (download)

>d5fehe2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnlqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5fehe2:

Click to download the PDB-style file with coordinates for d5fehe2.
(The format of our PDB-style files is described here.)

Timeline for d5fehe2: