SCOPe 2.07: Domain d5waud_: 5wau D:

Lineage for d5waud_ (5wau D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (28 PDB entries)

8. Domain d5waud_: 5wau D: [337821]
   Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_
   automated match to d1v54d_
   complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5waud_

PDB Entry: 5wau, 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k

PDB Compounds: (D:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5waud_:

Sequence; same for both SEQRES and ATOM records:

>d5waud_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d5waud_:

• d5waud_ first appeared in SCOPe 2.06
  
• d5waud_ appears in the current release, SCOPe 2.08