| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein Cytochrome c oxidase subunit E [48481] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48482] (35 PDB entries) |
| Domain d5w97e_: 5w97 E: [337819] Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_ automated match to d1v54e_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5w97 (more details), 2.3 Å
SCOPe Domain Sequences for d5w97e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w97e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5w97e_: