Lineage for d5waug_ (5wau G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630322Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 2630323Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 2630324Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 2630325Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries)
  8. 2630392Domain d5waug_: 5wau G: [337810]
    Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_
    automated match to d1v54g_
    complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5waug_

PDB Entry: 5wau (more details), 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d5waug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5waug_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d5waug_:

Click to download the PDB-style file with coordinates for d5waug_.
(The format of our PDB-style files is described here.)

Timeline for d5waug_: