Lineage for d5w97d_ (5w97 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024793Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 3024794Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 3024795Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3024796Species Cow (Bos taurus) [TaxId:9913] [81403] (32 PDB entries)
  8. 3024845Domain d5w97d_: 5w97 D: [337806]
    Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_
    automated match to d1v54d_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97d_

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (D:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5w97d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97d_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d5w97d_:

Click to download the PDB-style file with coordinates for d5w97d_.
(The format of our PDB-style files is described here.)

Timeline for d5w97d_: