SCOPe 2.06: Domain d5x1bo2: 5x1b O:91-227

Lineage for d5x1bo2 (5x1b O:91-227)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein automated matches [233094] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255752] (2 PDB entries)

8. Domain d5x1bo2: 5x1b O:91-227 [337805]
   Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
   automated match to d3ag3b2
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bo2

PDB Entry: 5x1b, 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5x1bo2:

Sequence; same for both SEQRES and ATOM records:

>d5x1bo2 b.6.1.2 (O:91-227) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d5x1bo2:

• d5x1bo2 is new in SCOPe 2.06-stable
  
• d5x1bo2 appears in SCOPe 2.07
  
• d5x1bo2 appears in the current release, SCOPe 2.08