SCOPe 2.06: Domain d5vzyl2: 5vzy L:108-213

Lineage for d5vzyl2 (5vzy L:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5vzyl2: 5vzy L:108-213 [337793]
   Other proteins in same PDB: d5vzyl1
   automated match to d1t66c2

Details for d5vzyl2

PDB Entry: 5vzy, 2.32 Å

PDB Description: crystal structure of crenezumab fab in complex with abeta

PDB Compounds: (L:) Crenezumab Fab light chain

SCOPe Domain Sequences for d5vzyl2:

Sequence; same for both SEQRES and ATOM records:

>d5vzyl2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5vzyl2:

• d5vzyl2 is new in SCOPe 2.06-stable
  
• d5vzyl2 appears in SCOPe 2.07
  
• d5vzyl2 appears in the current release, SCOPe 2.08