SCOPe 2.08: Domain d5vzyl1: 5vzy L:1-107

Lineage for d5vzyl1 (5vzy L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5vzyl1: 5vzy L:1-107 [337792]
   Other proteins in same PDB: d5vzyl2
   automated match to d1t66c1

Details for d5vzyl1

PDB Entry: 5vzy, 2.32 Å

PDB Description: crystal structure of crenezumab fab in complex with abeta

PDB Compounds: (L:) Crenezumab Fab light chain,Immunoblobulin light chain

SCOPe Domain Sequences for d5vzyl1:

Sequence; same for both SEQRES and ATOM records:

>d5vzyl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveik

Timeline for d5vzyl1:

• d5vzyl1 first appeared in SCOPe 2.06
  
• d5vzyl1 appears in SCOPe 2.07