Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Pseudomonas sp. [TaxId:1123041] [337779] (2 PDB entries) |
Domain d5xtfa_: 5xtf A: [337790] automated match to d3i3og_ |
PDB Entry: 5xtf (more details), 2.1 Å
SCOPe Domain Sequences for d5xtfa_:
Sequence, based on SEQRES records: (download)
>d5xtfa_ c.2.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 1123041]} nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp ggtvtslcgpasagfdkmhmkdmpgiddmikgltplgfaakpedvvapylllasrkqgkf itgtvisidggmalgr
>d5xtfa_ c.2.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 1123041]} nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp ggtvltplgfaakpedvvapylllasrkqgkfitgtvisidggmalgr
Timeline for d5xtfa_: