Lineage for d5xtfa_ (5xtf A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2432094Species Pseudomonas sp. [TaxId:1123041] [337779] (2 PDB entries)
  8. 2432095Domain d5xtfa_: 5xtf A: [337790]
    automated match to d3i3og_

Details for d5xtfa_

PDB Entry: 5xtf (more details), 2.1 Å

PDB Description: crystal structure of the cis-dihydrodiol naphthalene dehydrogenase nahb from pseudomonas sp. mc1
PDB Compounds: (A:) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase

SCOPe Domain Sequences for d5xtfa_:

Sequence, based on SEQRES records: (download)

>d5xtfa_ c.2.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 1123041]}
nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh
atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis
aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp
ggtvtslcgpasagfdkmhmkdmpgiddmikgltplgfaakpedvvapylllasrkqgkf
itgtvisidggmalgr

Sequence, based on observed residues (ATOM records): (download)

>d5xtfa_ c.2.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 1123041]}
nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh
atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis
aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp
ggtvltplgfaakpedvvapylllasrkqgkfitgtvisidggmalgr

SCOPe Domain Coordinates for d5xtfa_:

Click to download the PDB-style file with coordinates for d5xtfa_.
(The format of our PDB-style files is described here.)

Timeline for d5xtfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xtfb_