Lineage for d1ecpe_ (1ecp E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25491Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
  5. 25492Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins)
  6. 25497Protein Purine nucleoside phosphorylase, PNP [53169] (4 species)
  7. 25519Species Escherichia coli [TaxId:562] [53172] (2 PDB entries)
  8. 25524Domain d1ecpe_: 1ecp E: [33779]

Details for d1ecpe_

PDB Entry: 1ecp (more details), 2 Å

PDB Description: purine nucleoside phosphorylase

SCOP Domain Sequences for d1ecpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecpe_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Escherichia coli}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOP Domain Coordinates for d1ecpe_:

Click to download the PDB-style file with coordinates for d1ecpe_.
(The format of our PDB-style files is described here.)

Timeline for d1ecpe_: