SCOPe 2.05: Domain d1ecpd_: 1ecp D:

Lineage for d1ecpd_ (1ecp D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)

7. Species Escherichia coli [TaxId:562] [53172] (27 PDB entries)

8. Domain d1ecpd_: 1ecp D: [33778]

Details for d1ecpd_

PDB Entry: 1ecp, 2 Å

PDB Description: purine nucleoside phosphorylase

PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1ecpd_:

Sequence; same for both SEQRES and ATOM records:

>d1ecpd_ c.56.2.1 (D:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

Timeline for d1ecpd_:

• d1ecpd_ first appeared (with stable ids) in SCOP 1.55
  
• d1ecpd_ appears in SCOPe 2.04
  
• d1ecpd_ appears in SCOPe 2.06
  
• d1ecpd_ appears in the current release, SCOPe 2.08