![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries) |
![]() | Domain d5x1fp_: 5x1f P: [337752] Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ automated match to d1v54c_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1f (more details), 2.2 Å
SCOPe Domain Sequences for d5x1fp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1fp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d5x1fp_:
![]() Domains from other chains: (mouse over for more information) d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ |