Lineage for d5wmff_ (5wmf F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559568Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2559569Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2559627Protein automated matches [337642] (2 species)
    not a true protein
  7. 2559635Species Epstein-barr virus [TaxId:10377] [337643] (1 PDB entry)
  8. 2559641Domain d5wmff_: 5wmf F: [337750]
    automated match to d1b3ta_

Details for d5wmff_

PDB Entry: 5wmf (more details), 1.9 Å

PDB Description: crystal structure of the hexameric ring of epstein-barr virus nuclear antigen-1, ebna1
PDB Compounds: (F:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d5wmff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wmff_ d.58.8.1 (F:) automated matches {Epstein-barr virus [TaxId: 10377]}
snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
rvtvcsfddgvdlppwfppm

SCOPe Domain Coordinates for d5wmff_:

Click to download the PDB-style file with coordinates for d5wmff_.
(The format of our PDB-style files is described here.)

Timeline for d5wmff_: