Lineage for d5x1fr_ (5x1f R:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340250Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2340251Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2340252Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)
  8. 2340331Domain d5x1fr_: 5x1f R: [337733]
    Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
    automated match to d1v54e_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1fr_

PDB Entry: 5x1f (more details), 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k
PDB Compounds: (R:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5x1fr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1fr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5x1fr_:

Click to download the PDB-style file with coordinates for d5x1fr_.
(The format of our PDB-style files is described here.)

Timeline for d5x1fr_: