Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries) |
Domain d5vzwd1: 5vzw D:1-76 [337724] Other proteins in same PDB: d5vzwa_, d5vzwb_, d5vzwc2, d5vzwd2 automated match to d4k1rb_ complexed with zn |
PDB Entry: 5vzw (more details), 2.28 Å
SCOPe Domain Sequences for d5vzwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vzwd1 d.15.1.1 (D:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d5vzwd1:
View in 3D Domains from other chains: (mouse over for more information) d5vzwa_, d5vzwb_, d5vzwc1, d5vzwc2 |