SCOP 1.63: Domain d1fxua_: 1fxu A:

Lineage for d1fxua_ (1fxu A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53171] (13 PDB entries)

8. Domain d1fxua_: 1fxu A: [33772]
   complexed with gu7, mg, po4, zn

Details for d1fxua_

PDB Entry: 1fxu, 2.2 Å

PDB Description: purine nucleoside phosphorylase from calf spleen in complex with n(7)- acycloguanosine inhibitor and a phosphate ion

SCOP Domain Sequences for d1fxua_:

Sequence, based on SEQRES records:

>d1fxua_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
kvimdtesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records):

>d1fxua_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
kvimdtgkanheevleagkqaaqkleqfvsllmasipv

Timeline for d1fxua_:

• d1fxua_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxua_ appears in SCOP 1.61
  
• d1fxua_ appears in SCOP 1.65
  
• d1fxua_ appears in the current release, SCOPe 2.08