Lineage for d1fxua_ (1fxu A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25491Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
  5. 25492Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins)
  6. 25497Protein Purine nucleoside phosphorylase, PNP [53169] (4 species)
  7. 25505Species Cow (Bos taurus) [TaxId:9913] [53171] (13 PDB entries)
  8. Domain d1fxua_: 1fxu A: [33772]

Details for d1fxua_

PDB Entry: 1fxu (more details), 2.2 Å

PDB Description: purine nucleoside phosphorylase from calf spleen in complex with n(7)- acycloguanosine inhibitor and a phosphate ion

SCOP Domain Sequences for d1fxua_:

Sequence, based on SEQRES records: (download)

>d1fxua_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
kvimdtesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records): (download)

>d1fxua_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
kvimdtgkanheevleagkqaaqkleqfvsllmasipv

SCOP Domain Coordinates for d1fxua_ are not available.

Timeline for d1fxua_: