Class a: All alpha proteins [46456] (289 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein Cytochrome c oxidase subunit h [47696] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries) |
Domain d5x19h_: 5x19 H: [337712] Other proteins in same PDB: d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_ automated match to d1v54h_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x19 (more details), 2.2 Å
SCOPe Domain Sequences for d5x19h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x19h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5x19h_:
View in 3D Domains from other chains: (mouse over for more information) d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_ |