Lineage for d5x19h_ (5x19 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000513Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2000514Species Cow (Bos taurus) [TaxId:9913] [47697] (19 PDB entries)
  8. 2000543Domain d5x19h_: 5x19 H: [337712]
    Other proteins in same PDB: d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_
    automated match to d1v54h_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x19h_

PDB Entry: 5x19 (more details), 2.2 Å

PDB Description: co bound cytochrome c oxidase at 100 micro sec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5x19h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x19h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5x19h_:

Click to download the PDB-style file with coordinates for d5x19h_.
(The format of our PDB-style files is described here.)

Timeline for d5x19h_: