SCOPe 2.06: Domain d5wmfb_: 5wmf B:

Lineage for d5wmfb_ (5wmf B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein automated matches [337642] (1 species)
   not a true protein

7. Species Epstein-barr virus [TaxId:10377] [337643] (1 PDB entry)

8. Domain d5wmfb_: 5wmf B: [337709]
   automated match to d1b3ta_

Details for d5wmfb_

PDB Entry: 5wmf, 1.9 Å

PDB Description: crystal structure of the hexameric ring of epstein-barr virus nuclear antigen-1, ebna1

PDB Compounds: (B:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d5wmfb_:

Sequence; same for both SEQRES and ATOM records:

>d5wmfb_ d.58.8.1 (B:) automated matches {Epstein-barr virus [TaxId: 10377]}
npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
vtvcsfddgvdlppwfp

Timeline for d5wmfb_:

• d5wmfb_ is new in SCOPe 2.06-stable
  
• d5wmfb_ appears in SCOPe 2.07
  
• d5wmfb_ appears in the current release, SCOPe 2.08