SCOPe 2.08: Domain d5wmfb_: 5wmf B:

Lineage for d5wmfb_ (5wmf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
   DNA-binding mode differs from that of E2 protein

7. Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries)

8. Domain d5wmfb_: 5wmf B: [337709]
   automated match to d1b3ta_
   has additional insertions and/or extensions that are not grouped together

Details for d5wmfb_

PDB Entry: 5wmf, 1.9 Å

PDB Description: crystal structure of the hexameric ring of epstein-barr virus nuclear antigen-1, ebna1

PDB Compounds: (B:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d5wmfb_:

Sequence; same for both SEQRES and ATOM records:

>d5wmfb_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]}
npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
vtvcsfddgvdlppwfp

Timeline for d5wmfb_:

• d5wmfb_ first appeared in SCOPe 2.06
  
• d5wmfb_ appears in SCOPe 2.07