SCOPe 2.06: Domain d5ww8c_: 5ww8 C:

Lineage for d5ww8c_ (5ww8 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)

8. Domain d5ww8c_: 5ww8 C: [337707]
   automated match to d2z90a_
   complexed with cl, fe, fe2, mg

Details for d5ww8c_

PDB Entry: 5ww8, 2.04 Å

PDB Description: crystal structure of the second dna-binding protein under starvation from mycobacterium smegmatis soaked with iron in the ratio of 480 iron atoms per dodecamer

PDB Compounds: (C:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d5ww8c_:

Sequence, based on SEQRES records:

>d5ww8c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
irrvhdavdaedpstadllhglidglekqawlirsenrkv

Sequence, based on observed residues (ATOM records):

>d5ww8c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sarrtsdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvdf
aregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdti
rrvhdavdaedpstadllhglidglekqawlirsenrkv

Timeline for d5ww8c_:

• d5ww8c_ is new in SCOPe 2.06-stable
  
• d5ww8c_ appears in SCOPe 2.07
  
• d5ww8c_ appears in the current release, SCOPe 2.08