Lineage for d5xedc_ (5xed C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 2303713Protein Cytochrome c551 [46660] (5 species)
  7. 2303739Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271783] (3 PDB entries)
  8. 2303743Domain d5xedc_: 5xed C: [337706]
    Other proteins in same PDB: d5xeda_
    automated match to d1ynra_
    complexed with hec

Details for d5xedc_

PDB Entry: 5xed (more details), 1.55 Å

PDB Description: heterodimer constructed from m61a pa cyt c551-ht cyt c552 and ht cyt c552-pa cyt c551 chimeric proteins
PDB Compounds: (C:) Cytochrome c-552,Cytochrome c-551

SCOPe Domain Sequences for d5xedc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xedc_ a.3.1.1 (C:) Cytochrome c551 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
neqlakqkgcmachdlkakmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpipmp
pnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d5xedc_:

Click to download the PDB-style file with coordinates for d5xedc_.
(The format of our PDB-style files is described here.)

Timeline for d5xedc_: