SCOPe 2.08: Domain d5my6b1: 5my6 B:6-115

Lineage for d5my6b1 (5my6 B:6-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5my6b1: 5my6 B:6-115 [337704]
   Other proteins in same PDB: d5my6a1, d5my6a2, d5my6a3, d5my6b2
   automated match to d4ldeb_
   complexed with gol, nag

Details for d5my6b1

PDB Entry: 5my6, 2.25 Å

PDB Description: crystal structure of a her2-nb complex

PDB Compounds: (B:) Nanobody 2Rs15d

SCOPe Domain Sequences for d5my6b1:

Sequence; same for both SEQRES and ATOM records:

>d5my6b1 b.1.1.1 (B:6-115) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esgggsvqaggslkltcaasgyifnscgmgwyrqspgrerelvsrisgdgdtwhkesvkg
rftisqdnvkktlylqmnslkpedtavyfcavcynletywgqgtqvtvss

Timeline for d5my6b1:

• d5my6b1 first appeared in SCOPe 2.06, called d5my6b_
  
• d5my6b1 appears in SCOPe 2.07