Lineage for d5ww9c_ (5ww9 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (42 species)
    not a true protein
  7. 2314858Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)
  8. 2314902Domain d5ww9c_: 5ww9 C: [337696]
    automated match to d2z90a_
    complexed with cl, fe, mg; mutant

Details for d5ww9c_

PDB Entry: 5ww9 (more details), 2 Å

PDB Description: crystal structure of r73e mutant of the second dna-binding protein under starvation from mycobacterium smegmatis
PDB Compounds: (C:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d5ww9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ww9c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
faregsdtiaeemraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
irrvhdavdaedpstadllhglidglekqawlirsenrkv

SCOPe Domain Coordinates for d5ww9c_:

Click to download the PDB-style file with coordinates for d5ww9c_.
(The format of our PDB-style files is described here.)

Timeline for d5ww9c_: