Lineage for d1a9qa_ (1a9q A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996948Protein Purine nucleoside phosphorylase, PNP [53169] (10 species)
  7. 996966Species Cow (Bos taurus) [TaxId:9913] [53171] (20 PDB entries)
    Uniprot P55859
  8. 996986Domain d1a9qa_: 1a9q A: [33769]
    complexed with hpa, so4

Details for d1a9qa_

PDB Entry: 1a9q (more details), 2 Å

PDB Description: bovine purine nucleoside phosphorylase complexed with inosine
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1a9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9qa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasi

SCOPe Domain Coordinates for d1a9qa_:

Click to download the PDB-style file with coordinates for d1a9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1a9qa_: