Lineage for d5w97k_ (5w97 K:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2253892Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 2253893Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 2253894Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2253895Species Cow (Bos taurus) [TaxId:9913] [81420] (19 PDB entries)
  8. 2253930Domain d5w97k_: 5w97 K: [337679]
    Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97l_, d5w97m_
    automated match to d1v54k_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97k_

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (K:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5w97k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d5w97k_:

Click to download the PDB-style file with coordinates for d5w97k_.
(The format of our PDB-style files is described here.)

Timeline for d5w97k_: