| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein Cytochrome c oxidase subunit E [48481] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries) |
| Domain d5x1fe_: 5x1f E: [337676] Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ automated match to d1v54e_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1f (more details), 2.2 Å
SCOPe Domain Sequences for d5x1fe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1fe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5x1fe_:
View in 3DDomains from other chains: (mouse over for more information) d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1ff_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ |