Lineage for d1a9r__ (1a9r -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398089Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 398090Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)
  6. 398141Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)
  7. 398149Species Cow (Bos taurus) [TaxId:9913] [53171] (15 PDB entries)
  8. 398153Domain d1a9r__: 1a9r - [33767]
    complexed with hpa, so4

Details for d1a9r__

PDB Entry: 1a9r (more details), 2 Å

PDB Description: bovine purine nucleoside phosphorylase complexed with hypoxanthine and sulfate

SCOP Domain Sequences for d1a9r__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9r__ c.56.2.1 (-) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasi

SCOP Domain Coordinates for d1a9r__:

Click to download the PDB-style file with coordinates for d1a9r__.
(The format of our PDB-style files is described here.)

Timeline for d1a9r__: