SCOP 1.65: Domain d1a9r__: 1a9r -

Lineage for d1a9r__ (1a9r -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53171] (13 PDB entries)

8. Domain d1a9r__: 1a9r - [33767]
   complexed with hpa, so4

Details for d1a9r__

PDB Entry: 1a9r, 2 Å

PDB Description: bovine purine nucleoside phosphorylase complexed with hypoxanthine and sulfate

SCOP Domain Sequences for d1a9r__:

Sequence; same for both SEQRES and ATOM records:

>d1a9r__ c.56.2.1 (-) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasi

Timeline for d1a9r__:

• d1a9r__ first appeared (with stable ids) in SCOP 1.55
  
• d1a9r__ appears in SCOP 1.63
  
• d1a9r__ appears in SCOP 1.67
  
• d1a9r__ appears in the current release, SCOPe 2.08, called d1a9ra_