![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81420] (19 PDB entries) |
![]() | Domain d5x19k_: 5x19 K: [337662] Other proteins in same PDB: d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19h_, d5x19i_, d5x19j_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19y_, d5x19z_ automated match to d1v54k_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x19 (more details), 2.2 Å
SCOPe Domain Sequences for d5x19k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x19k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d5x19k_:
![]() Domains from other chains: (mouse over for more information) d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19e_, d5x19f_, d5x19g_, d5x19h_, d5x19i_, d5x19j_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19r_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_ |