Lineage for d1b8na_ (1b8n A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) 
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) Protein Purine nucleoside phosphorylase, PNP [53169] (4 species) Species Cow (Bos taurus) [TaxId:9913] [53171] (13 PDB entries) 
Domain d1b8na_: 1b8n A: [33766]
Details for d1b8na_
PDB Entry: 1b8n (more details), 2 Å
PDB Description: purine nucleoside phosphorylase
SCOP Domain Sequences for d1b8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8na_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus)}
qngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestv
pghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggln
pnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqm
geqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsli
tnkvimdyesqgkanheevleagkqaaqkleqfvsllm
SCOP Domain Coordinates for d1b8na_:
Click to download the PDB-style file with coordinates for d1b8na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8na_:
- d1b8na_ appears in SCOP 1.57
- d1b8na_ appears in the current release, SCOPe 2.08
View in 3D