Lineage for d5wmfe_ (5wmf E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195834Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2195835Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2195886Protein automated matches [337642] (1 species)
    not a true protein
  7. 2195887Species Epstein-barr virus [TaxId:10377] [337643] (1 PDB entry)
  8. 2195892Domain d5wmfe_: 5wmf E: [337648]
    automated match to d1b3ta_

Details for d5wmfe_

PDB Entry: 5wmf (more details), 1.9 Å

PDB Description: crystal structure of the hexameric ring of epstein-barr virus nuclear antigen-1, ebna1
PDB Compounds: (E:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d5wmfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wmfe_ d.58.8.1 (E:) automated matches {Epstein-barr virus [TaxId: 10377]}
kfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltpl
srlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirvt
vcsfddgvdlppwfp

SCOPe Domain Coordinates for d5wmfe_:

Click to download the PDB-style file with coordinates for d5wmfe_.
(The format of our PDB-style files is described here.)

Timeline for d5wmfe_: