| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
| Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
| Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species) DNA-binding mode differs from that of E2 protein |
| Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries) |
| Domain d5wmfa_: 5wmf A: [337644] automated match to d1b3ta_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5wmf (more details), 1.9 Å
SCOPe Domain Sequences for d5wmfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wmfa_ d.58.8.1 (A:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]}
npkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrlt
plsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnir
vtvcsfddgvdlppwfp
Timeline for d5wmfa_: