SCOP 1.75: Domain d3pnpa_: 3pnp A:

Lineage for d3pnpa_ (3pnp A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53171] (20 PDB entries)
   Uniprot P55859

8. Domain d3pnpa_: 3pnp A: [33763]
   complexed with mg, po4

Details for d3pnpa_

PDB Entry: 3pnp, 1.6 Å

PDB Description: the high resolution crystal structure of bovine spleen purine nucleoside phosphorylase in complex forms with phosphate and 9-deazainosine

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOP Domain Sequences for d3pnpa_:

Sequence, based on SEQRES records:

>d3pnpa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mangytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records):

>d3pnpa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mangytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvaaqkleqfvsllmasipv

Timeline for d3pnpa_:

• d3pnpa_ first appeared (with stable ids) in SCOP 1.55, called d3pnp__
  
• d3pnpa_ appears in SCOP 1.73
  
• d3pnpa_ appears in SCOPe 2.01
  
• d3pnpa_ appears in the current release, SCOPe 2.08