SCOPe 2.07: Domain d5l2va_: 5l2v A:

Lineage for d5l2va_ (5l2v A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:393133] [337606] (1 PDB entry)

8. Domain d5l2va_: 5l2v A: [337627]
   automated match to d2bema_
   complexed with cu, p33

Details for d5l2va_

PDB Entry: 5l2v, 1.1 Å

PDB Description: catalytic domain of lpmo lmo2467 from listeria monocytogenes

PDB Compounds: (A:) Chitin-binding protein

SCOPe Domain Sequences for d5l2va_:

Sequence; same for both SEQRES and ATOM records:

>d5l2va_ b.1.18.0 (A:) automated matches {Listeria monocytogenes [TaxId: 393133]}
hgyiskpasrvylankginvgvgsaqyepqsveapkgfpisgpadgsiagggkyslldeq
sasrwakvdiesgpltvewtltaphktsswqyfitkkgwdpnkpltrssleplatieadg
svpnalakqeinipndrsgyylilgvwniadtgnafyqvidaniin

Timeline for d5l2va_:

• d5l2va_ first appeared in SCOPe 2.06
  
• d5l2va_ appears in the current release, SCOPe 2.08