Lineage for d5l2va_ (5l2v A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376260Species Listeria monocytogenes [TaxId:393133] [337606] (1 PDB entry)
  8. 2376261Domain d5l2va_: 5l2v A: [337627]
    automated match to d2bema_
    complexed with cu, p33

Details for d5l2va_

PDB Entry: 5l2v (more details), 1.1 Å

PDB Description: catalytic domain of lpmo lmo2467 from listeria monocytogenes
PDB Compounds: (A:) Chitin-binding protein

SCOPe Domain Sequences for d5l2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2va_ b.1.18.0 (A:) automated matches {Listeria monocytogenes [TaxId: 393133]}
hgyiskpasrvylankginvgvgsaqyepqsveapkgfpisgpadgsiagggkyslldeq
sasrwakvdiesgpltvewtltaphktsswqyfitkkgwdpnkpltrssleplatieadg
svpnalakqeinipndrsgyylilgvwniadtgnafyqvidaniin

SCOPe Domain Coordinates for d5l2va_:

Click to download the PDB-style file with coordinates for d5l2va_.
(The format of our PDB-style files is described here.)

Timeline for d5l2va_: