Lineage for d5k8am2 (5k8a M:106-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752689Domain d5k8am2: 5k8a M:106-213 [337616]
    Other proteins in same PDB: d5k8aa1, d5k8ab_, d5k8ae1, d5k8af_, d5k8ah_, d5k8al1, d5k8am1, d5k8av_
    automated match to d1dn0a2

Details for d5k8am2

PDB Entry: 5k8a (more details), 2 Å

PDB Description: nist fab
PDB Compounds: (M:) humanized Fab Lite chain

SCOPe Domain Sequences for d5k8am2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k8am2 b.1.1.2 (M:106-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5k8am2:

Click to download the PDB-style file with coordinates for d5k8am2.
(The format of our PDB-style files is described here.)

Timeline for d5k8am2: