SCOPe 2.08: Domain d5w3xb_: 5w3x B:

Lineage for d5w3xb_ (5w3x B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.79: WRKY DNA-binding domain [118289] (1 superfamily)
   zinc-bound 4-stranded meander beta-sheet, distinct from the beta-ribbon motifs

4. Superfamily g.79.1: WRKY DNA-binding domain [118290] (2 families)

5. Family g.79.1.0: automated matches [191385] (1 protein)
   not a true family

6. Protein automated matches [190488] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187430] (4 PDB entries)

8. Domain d5w3xb_: 5w3x B: [337610]
   automated match to d1wj2a_
   complexed with aco, gol, ihp, zn

Details for d5w3xb_

PDB Entry: 5w3x, 2 Å

PDB Description: crystal structure of popp2 in complex with ip6, accoa and the wrky domain of rrs1-r .

PDB Compounds: (B:) Disease resistance protein RRS1

SCOPe Domain Sequences for d5w3xb_:

Sequence; same for both SEQRES and ATOM records:

>d5w3xb_ g.79.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
idegdlwtwrkygqkdilgsrfprgyyrcaykfthgckatkqvqrsetdsnmlaitylse
hnhprpt

Timeline for d5w3xb_:

• d5w3xb_ first appeared in SCOPe 2.06
  
• d5w3xb_ appears in SCOPe 2.07