Lineage for d5w3xb_ (5w3x B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038703Fold g.79: WRKY DNA-binding domain [118289] (1 superfamily)
    zinc-bound 4-stranded meander beta-sheet, distinct from the beta-ribbon motifs
  4. 3038704Superfamily g.79.1: WRKY DNA-binding domain [118290] (2 families) (S)
  5. 3038710Family g.79.1.0: automated matches [191385] (1 protein)
    not a true family
  6. 3038711Protein automated matches [190488] (1 species)
    not a true protein
  7. 3038712Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187430] (4 PDB entries)
  8. 3038714Domain d5w3xb_: 5w3x B: [337610]
    automated match to d1wj2a_
    complexed with aco, gol, ihp, zn

Details for d5w3xb_

PDB Entry: 5w3x (more details), 2 Å

PDB Description: crystal structure of popp2 in complex with ip6, accoa and the wrky domain of rrs1-r .
PDB Compounds: (B:) Disease resistance protein RRS1

SCOPe Domain Sequences for d5w3xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3xb_ g.79.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
idegdlwtwrkygqkdilgsrfprgyyrcaykfthgckatkqvqrsetdsnmlaitylse
hnhprpt

SCOPe Domain Coordinates for d5w3xb_:

Click to download the PDB-style file with coordinates for d5w3xb_.
(The format of our PDB-style files is described here.)

Timeline for d5w3xb_: