| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (55 species) not a true protein |
| Species Listeria monocytogenes [TaxId:393133] [337606] (1 PDB entry) |
| Domain d5l2vb_: 5l2v B: [337607] automated match to d2bema_ complexed with cu, p33 |
PDB Entry: 5l2v (more details), 1.1 Å
SCOPe Domain Sequences for d5l2vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l2vb_ b.1.18.0 (B:) automated matches {Listeria monocytogenes [TaxId: 393133]}
hgyiskpasrvylankginvgvgsaqyepqsveapkgfpisgpadgsiagggkyslldeq
sasrwakvdiesgpltvewtltaphktsswqyfitkkgwdpnkpltrssleplatieadg
svpnalakqeinipndrsgyylilgvwniadtgnafyqvidaniin
Timeline for d5l2vb_: